PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010527487.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family GATA
Protein Properties Length: 282aa    MW: 30791.6 Da    PI: 7.8057
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010527487.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA611.5e-19203237135
            GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                     C++Cg+ kTp+WR gp+g+ktLCnaCG+++++ +l
  XP_010527487.1 203 CTHCGSEKTPQWRAGPSGPKTLCNACGVRFKSGRL 237
                     *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011412.848197233IPR000679Zinc finger, GATA-type
SMARTSM004016.3E-17197247IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.09E-14199260No hitNo description
Gene3DG3DSA:3.30.50.105.9E-15201235IPR013088Zinc finger, NHR/GATA-type
CDDcd002027.30E-15202259No hitNo description
PROSITE patternPS003440203228IPR000679Zinc finger, GATA-type
PfamPF003203.3E-17203237IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MKSMEIEPFI MDDLLNFSVP EEDDNEEDEA AEVRPLAMKT LSRREKIIRS AESFGLIGPD  60
DPELVEEEDL EWISNKDAFP VIETFVGMLP SEQHVRLTWP EQASAKQLSP VSVLETSSHS  120
HSSATLTTTA TTTNSSGSSN GSAAAVSGGA ATTVMSCCGG LSVPVKARSK RRRTGRRDLR  180
GLWTHREQTP PRKKPASTLG RKCTHCGSEK TPQWRAGPSG PKTLCNACGV RFKSGRLVPE  240
YRPANSPTFS AEVHSNSHRK IIEMRKQRQL GVASAGDRED CG
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00377DAPTransfer from AT3G24050Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010527487.10.0PREDICTED: LOW QUALITY PROTEIN: GATA transcription factor 1-like
SwissprotQ8LAU91e-87GATA1_ARATH; GATA transcription factor 1
TrEMBLV4MXL82e-99V4MXL8_EUTSA; Uncharacterized protein
STRINGBra001925.1-P3e-87(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM129872430
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24050.11e-72GATA transcription factor 1